PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa014320
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 320aa    MW: 36424.6 Da    PI: 4.2162
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-22083PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.88.9e-1994147356
                --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                k+++++++q++ Le+ Fe ++++  +++ +LAk+lgL+ rq+ +WFqNrRa++k
  Lsa014320  94 KKRRLKADQVQFLEKSFETENKLEPDRKIQLAKELGLQPRQIAIWFQNRRARWK 147
                566899***********************************************9 PP

2HD-ZIP_I/II125.22.9e-4093185193
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelke 93 
                  ekkrrl+++qv++LE+sFe+e+kLep+rK +la+eLglqprq+a+WFqnrRAR+ktk+lEkdy++L+++y++lk++ e+L +e+e+L++e+++
    Lsa014320  93 EKKRRLKADQVQFLEKSFETENKLEPDRKIQLAKELGLQPRQIAIWFQNRRARWKTKRLEKDYDVLQESYNELKANYENLLSEKEKLKSEVHD 185
                  69**************************************************************************************99975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.41E-1882150IPR009057Homeodomain-like
PROSITE profilePS5007117.10389149IPR001356Homeobox domain
SMARTSM003891.7E-1892153IPR001356Homeobox domain
CDDcd000862.25E-1794150No hitNo description
PfamPF000465.5E-1694147IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.606.3E-2096156IPR009057Homeodomain-like
PRINTSPR000319.1E-6120129IPR000047Helix-turn-helix motif
PROSITE patternPS000270124147IPR017970Homeobox, conserved site
PRINTSPR000319.1E-6129145IPR000047Helix-turn-helix motif
PfamPF021838.3E-13149190IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 320 aa     Download sequence    Send to blast
MAARSFLYGG DSGGGGGSGF NSVLVTNKRP PFSSSIPLDS HFVSGSTHSF AGARSMVSFD  60
QEGGNGSGRN FFQTFDQEDN GDDEYDDYFQ HPEKKRRLKA DQVQFLEKSF ETENKLEPDR  120
KIQLAKELGL QPRQIAIWFQ NRRARWKTKR LEKDYDVLQE SYNELKANYE NLLSEKEKLK  180
SEVHDLNDKL LLQEMEKGTS DSSSTKSPCE PLQQEQAADC LNDEDVGVRS DATESSSLQY  240
VDLLERGDSS YLFEQDQSDE SLDEEDKLEK MFVTTVSGYM LPKIENGDYP ELDVVNSSYL  300
EFPSHGEDED EDQPFGFWSY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
19398KKRRLK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002321530.21e-102hypothetical protein POPTR_0015s07640g
TrEMBLA0A118K3S81e-153A0A118K3S8_CYNCS; Helix-turn-helix motif-containing protein
STRINGPOPTR_0015s07640.11e-101(Populus trichocarpa)